Loading...
Statistics
Advertisement

apztec Support
www.apztec.com/

Apztec.com

Advertisement
Conversion Technology Metas Server
Apztec.com is hosted in United States / Ashburn . Apztec.com uses HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Javascript, Number of used javascripts: 3. First javascripts: Jquery-1.11.1.min.js, Main.js, Lhnchatbutton-current.min.js, Number of used analytics tools: 0. Its server type is: nginx/1.11.3.

Technologies in use by Apztec.com

Technology

Number of occurences: 4
  • CSS
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 3
  • jquery-1.11.1.min.js
  • main.js
  • lhnchatbutton-current.min.js

Server Type

  • nginx/1.11.3

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Apztec.com

SSL certificate

    • name: /OU=Domain Control Validated/CN=dateprofits.com
    • subject:
      • OU: Domain Control Validated
      • CN: dateprofits.com
    • hash: 343841ce
    • issuer:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: GoDaddy.com, Inc.
      • OU: http://certs.godaddy.com/repository/
      • CN: Go Daddy Secure Certificate Authority - G2
    • version: 2
    • serialNumber: 5426078640912611477
    • validFrom: 160225225439Z
    • validTo: 180225225439Z
    • validFrom_time_t: 1456440879
    • validTo_time_t: 1519599279
    • extensions:
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://crl.godaddy.com/gdig2s1-200.crl
      • certificatePolicies: Policy: 2.16.840.1.114413.1.7.23.1 CPS: http://certificates.godaddy.com/repository/
      • authorityInfoAccess: OCSP - URI:http://ocsp.godaddy.com/ CA Issuers - URI:http://certificates.godaddy.com/repository/gdig2.crt
      • authorityKeyIdentifier: keyid:40:C2:BD:27:8E:CC:34:83:30:A2:33:D7:FB:6C:B3:F0:B4:2C:80:CE
      • subjectAltName: DNS:dateprofits.com, DNS:www.dateprofits.com
      • subjectKeyIdentifier: 0C:8E:FA:57:52:36:EE:B0:CB:ED:9C:55:87:83:F4:3F:5A:5A:4D:A2

Meta - Apztec.com

Number of occurences: 1
  • Name:
    Content: text/html; charset=utf-8

Server / Hosting

  • IP: 54.88.230.97
  • Latitude: 39.05
  • Longitude: -77.47
  • Country: United States
  • City: Ashburn

Rname

  • ns-643.awsdns-16.net
  • ns-1492.awsdns-58.org
  • ns-1839.awsdns-37.co.uk
  • ns-21.awsdns-02.com
  • alt1.aspmx.l.google.com
  • alt2.aspmx.l.google.com
  • aspmx.l.google.com
  • aspmx2.googlemail.com
  • aspmx3.googlemail.com

Target

  • awsdns-hostmaster.amazon.com

HTTP Header Response

HTTP/1.1 200 OK Content-Type: text/html Date: Sat, 08 Oct 2016 02:14:01 GMT Server: nginx/1.11.3 X-Cache: MISS from s_wx1189 Transfer-Encoding: chunked Via: 1.1 s_wx1189 (squid/3.5.20) Connection: keep-alive

DNS

host: apztec.com
  1. class: IN
  2. ttl: 86400
  3. type: A
  4. ip: 54.164.146.37
host: apztec.com
  1. class: IN
  2. ttl: 172800
  3. type: NS
  4. target: ns-643.awsdns-16.net
host: apztec.com
  1. class: IN
  2. ttl: 172800
  3. type: NS
  4. target: ns-1492.awsdns-58.org
host: apztec.com
  1. class: IN
  2. ttl: 172800
  3. type: NS
  4. target: ns-1839.awsdns-37.co.uk
host: apztec.com
  1. class: IN
  2. ttl: 172800
  3. type: NS
  4. target: ns-21.awsdns-02.com
host: apztec.com
  1. class: IN
  2. ttl: 900
  3. type: SOA
  4. mname: ns-643.awsdns-16.net
  5. rname: awsdns-hostmaster.amazon.com
  6. serial: 1
  7. refresh: 7200
  8. retry: 900
  9. expire: 1209600
  10. minimum-ttl: 86400
host: apztec.com
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 5
  5. target: alt1.aspmx.l.google.com
host: apztec.com
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 5
  5. target: alt2.aspmx.l.google.com
host: apztec.com
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 1
  5. target: aspmx.l.google.com
host: apztec.com
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 10
  5. target: aspmx2.googlemail.com
host: apztec.com
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 10
  5. target: aspmx3.googlemail.com
host: apztec.com
  1. class: IN
  2. ttl: 86400
  3. type: TXT
  4. txt: google-site-verification=lDJbbd1IzVCJ-gb3J_cHvlXInWhTbV048AclNWisB54
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.pztec.com, www.aopztec.com, www.opztec.com, www.appztec.com, www.ppztec.com, www.a9pztec.com, www.9pztec.com, www.apztec.com, www.pztec.com, www.aipztec.com, www.ipztec.com, www.aupztec.com, www.upztec.com, www.aztec.com, www.apiztec.com, www.aiztec.com, www.apkztec.com, www.akztec.com, www.apuztec.com, www.auztec.com, www.apjztec.com, www.ajztec.com, www.aplztec.com, www.alztec.com, www.aptec.com, www.apzttec.com, www.apttec.com, www.apzatec.com, www.apatec.com, www.apzstec.com, www.apstec.com, www.apzxtec.com, www.apxtec.com, www.apzctec.com, www.apctec.com, www.apzgtec.com, www.apgtec.com, www.apzhtec.com, www.aphtec.com, www.apzjtec.com, www.apjtec.com, www.apzutec.com, www.aputec.com, www.apzec.com, www.apztqec.com, www.apzqec.com, www.apztaec.com, www.apzaec.com, www.apzt ec.com, www.apz ec.com, www.apztwec.com, www.apzwec.com, www.apzteec.com, www.apzeec.com, www.apztzec.com, www.apzzec.com, www.apztxec.com, www.apzxec.com, www.apztcec.com, www.apzcec.com, www.apztc.com, www.apztexc.com, www.apztxc.com, www.apztesc.com, www.apztsc.com, www.apztewc.com, www.apztwc.com, www.apzterc.com, www.apztrc.com, www.apztefc.com, www.apztfc.com, www.apztevc.com, www.apztvc.com, www.apztecc.com, www.apztcc.com, www.apzteqc.com, www.apztqc.com, www.apzteac.com, www.apztac.com, www.apzteyc.com, www.apztyc.com, www.apzte.com, www.apztecd.com, www.apzted.com, www.apztecr.com, www.apzter.com, www.apztect.com, www.apztet.com, www.apztecv.com, www.apztev.com, www.apztecf.com, www.apztef.com, www.apztecg.com, www.apzteg.com, www.apztech.com, www.apzteh.com, www.apztecn.com, www.apzten.com, www.apztecm.com, www.apztem.com, www.apztecj.com, www.apztej.com,

Other websites we recently analyzed

  1. rosanne.
    San Francisco (United States) - 192.0.78.24
    Server software: nginx
    Technology: CSS, Google Font API, Gravatar, Html, Html5, Javascript, Php, Pingback, Shortcodes, SVG, comScore, Wordpress
    Number of Javascript: 6
    Number of meta tags: 9
  2. Fotos
    Dallas (United States) - 67.228.150.34
    Server software: Microsoft-IIS/7.5
    Technology: Html
    Number of meta tags: 1
  3. pennsylvaniamalpracticelawyers.info
    Scottsdale (United States) - 50.63.202.62
    Server software:
    Technology: Html, Html5, Iframe
  4. Pet Kraft
    United States - 208.91.199.87
    Server software: Apache Phusion_Passenger/4.0.10 mod_bwlimited/1.4 mod_fcgid/2.3.9
    Technology: CSS, Html, Javascript, jQuery, Php
    Number of Javascript: 8
    Number of meta tags: 1
  5. califoncoffee.com
    Scottsdale (United States) - 184.168.221.61
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  6. donateordance.net
    Scottsdale (United States) - 184.168.221.63
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  7. Home
    Studio City (United States) - 205.144.171.109
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 4
    Number of meta tags: 3
  8. 형제천막기업
    Korea, Republic of - 211.49.99.79
    Server software: Apache/2.2.6 (Unix) mod_ssl/2.2.6  PHP/5.2.17
    Technology: CSS, Html, Html5, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 5
  9. windsorsquaremovingsale.com
    Dublin (Ireland) - 79.125.118.219
    Server software:
    Technology: CSS, Html
  10. Serviços e Comunicação Visual - Plotar Mais
    A Plotar Mais é uma empresa nova no mercado que visa prestar serviços de plotagens e comunicação visual com foco em qualidade e desenvolvimento sustentável.
    Houston (United States) - 108.167.188.190
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, Php, Swf Object, Google Analytics, Facebook Like button
    Number of Javascript: 2
    Number of meta tags: 6

Check Other Websites